Protein Info for IAI46_03295 in Serratia liquefaciens MT49

Annotation: acetolactate synthase large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00118: acetolactate synthase, large subunit, biosynthetic type
  • amino acids 14 to 563 (550 residues), 682.3 bits, E=2.5e-209
• PF02776: TPP_enzyme_N
  • amino acids 14 to 128 (115 residues), 137.5 bits, E=3e-44
• PF00205: TPP_enzyme_M
  • amino acids 201 to 336 (136 residues), 158 bits, E=1.8e-50
• PF02775: TPP_enzyme_C
  • amino acids 392 to 539 (148 residues), 179 bits, E=8e-57

Best Hits

Swiss-Prot: 76% identical to ILVB_ECOLI: Acetolactate synthase isozyme 1 large subunit (ilvB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to srr:SerAS9_0668)

MetaCyc: 76% identical to acetohydroxy acid synthase I subunit IlvB (Escherichia coli K-12 substr. MG1655)
Acetolactate synthase. [EC: 2.2.1.6]; 2.2.1.6 [EC: 2.2.1.6]

Predicted SEED Role

"Acetolactate synthase large subunit (EC 2.2.1.6)" in subsystem Acetoin, butanediol metabolism or Branched-Chain Amino Acid Biosynthesis (EC 2.2.1.6)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-threonine metabolism (15/18 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-valine biosynthesis (4/4 steps found)
• pyruvate fermentation to (S)-acetoin (3/3 steps found)
• superpathway of 2,3-butanediol biosynthesis (5/6 steps found)
• pyruvate fermentation to (R)-acetoin II (2/2 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• pyruvate fermentation to (R)-acetoin I (2/3 steps found)
• L-isoleucine biosynthesis IV (4/6 steps found)
• superpathway of (R,R)-butanediol biosynthesis (3/5 steps found)
• L-isoleucine biosynthesis III (4/7 steps found)
• L-isoleucine biosynthesis II (4/8 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Butanoate metabolism
• C5-Branched dibasic acid metabolism
• Pantothenate and CoA biosynthesis
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.6

Use Curated BLAST to search for 2.2.1.6

Protein Sequence (564 amino acids)

>IAI46_03295 acetolactate synthase large subunit (Serratia liquefaciens MT49)
MAISGTPHQGNRFTGAELIVHLLERQGITTVAGIPGGAALPLYDALSQSTRIHHVLARHE
QGAGFMAQGMARANGKAAVCIASSGPGATNLVTAIADAKLDSIPLVCITGQVPSSMIGTD
AFQEVDTYGISIPITKHNHLVRDIRELPQVICDAFRIAESGRPGPVWIDVPKDVQTAVIS
LDELPPIAVPDAAPTFEATAVAQAAAMINQAKRPVLYLGGGIICANAYQQAIELAERANL
PTTMTLMALGAMPVQHPLSLGMLGMHAARSTNFILQEADLLIVLGARFDDRAIGKTEQFC
PNASIIHVDIDRAELGKVKQANIAIHADVGQVLQQLLPQIEAQPRSEWLSTVNDLKREFP
FSMPNAEDPLSHYGLVLAAARCVDENAIITTDVGQHQMWVAQAYPLSRPRQWLTSGGLGT
MGFGLPAAIGAALAEPQRKVLCFSGDGSLMMNIQEMATAVEHDLDVKIILMNNQALGLVH
QQQTLFYQQRIFAAAYPKRTDFIKIAAGFGMDTCDLNAAEDPQAALAEAIQRPGPCLIHA
LIDINEKVFPMVPPGAANIDMIGE