Protein Info for IAI46_03165 in Serratia liquefaciens MT49

Annotation: sugar porter family MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details transmembrane" amino acids 55 to 72 (18 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 141 to 159 (19 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 251 to 273 (23 residues), see Phobius details amino acids 292 to 310 (19 residues), see Phobius details amino acids 321 to 341 (21 residues), see Phobius details amino acids 348 to 372 (25 residues), see Phobius details amino acids 384 to 405 (22 residues), see Phobius details amino acids 417 to 435 (19 residues), see Phobius details TIGR00879: MFS transporter, sugar porter (SP) family" amino acids 12 to 445 (434 residues), 434 bits, see alignment E=3.7e-134 PF00083: Sugar_tr" amino acids 17 to 448 (432 residues), 425.7 bits, see alignment E=3.6e-131 PF07690: MFS_1" amino acids 22 to 381 (360 residues), 131.9 bits, see alignment E=4.1e-42 amino acids 287 to 438 (152 residues), 36.8 bits, see alignment E=3.5e-13 PF06609: TRI12" amino acids 35 to 197 (163 residues), 23.8 bits, see alignment E=2.2e-09

Best Hits

Swiss-Prot: 69% identical to GALP_ECOLI: Galactose-proton symporter (galP) from Escherichia coli (strain K12)

KEGG orthology group: K08137, MFS transporter, SP family, galactose:H+ symporter (inferred from 88% identity to spe:Spro_0710)

MetaCyc: 69% identical to galactose:H+ symporter (Escherichia coli K-12 substr. MG1655)
RXN0-7077; TRANS-RXN-21

Predicted SEED Role

"Arabinose-proton symporter" in subsystem L-Arabinose utilization

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (476 amino acids)

>IAI46_03165 sugar porter family MFS transporter (Serratia liquefaciens MT49)
MNKSSISAKTNRQTLQVCFLAALAGLLFGLDMGVIAGALPFLANEFSLSSQQQEIVVSIM
MFGAALGALSSWPMSSHLGRKKSLLLGAVLFVVGSIGCAVAQNLEVLVISRFILGLAVGI
ASFTAPLYLSEIAPERIRGSMISLYQLMITIGILAAFLSDTAFSAGGHWRWMLGIITFPA
LVLFIGVLTLPESPRWLAMKGRGELAGKVLQLLRNSDAEARDELNQIRESLQMKQRGWQL
FRHNAHFRRSAYLGVLLQFMQQFTGMTIIMYYAPKIFEIAGFATTREQMWCTVIAGLTNV
LATFIAIALVDHWGRKPILKLGFSLMAICMATLGYMFYIGIGNPTEQYAAVTVLLIFIIG
FAMSAGPLIWVLCSEIQPLAGRDFGVTCSTMANWIANMIIGATFLTLIDNLGSAGTFWLY
ALLNLLCIVLTLCFVPETKNISLECIEKNLMQGASLRHIGRPPQPKTTDHSLNTPA