Protein Info for IAI46_03160 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 transmembrane" amino acids 26 to 44 (19 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 117 to 140 (24 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details amino acids 256 to 278 (23 residues), see Phobius details amino acids 291 to 311 (21 residues), see Phobius details amino acids 323 to 341 (19 residues), see Phobius details amino acids 347 to 368 (22 residues), see Phobius details amino acids 377 to 399 (23 residues), see Phobius details amino acids 416 to 435 (20 residues), see Phobius details PF07690: MFS_1" amino acids 30 to 399 (370 residues), 173.6 bits, see alignment E=2.8e-55

Best Hits

Swiss-Prot: 46% identical to TUB3_AGRVI: Putative tartrate transporter (ttuB) from Agrobacterium vitis

KEGG orthology group: None (inferred from 94% identity to spe:Spro_0709)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (466 amino acids)

>IAI46_03160 MFS transporter (Serratia liquefaciens MT49)
MKLTTENPTAEQAAETKVYGKITRRLIPFLILCYFFAYLDRVNVGFAKLHMQDALSFSDT
VYGLGAGIFFIGYFIFELPSNLLMQRFGPRFWIARIMATWAILSAAMMFVTTPTTFYVLR
FLLGVAEAGFFPGIVFYLTLWFPSWRSARTLGLFILVTPLSVIIGSPLSGLILKLFENVG
GLHNWQWLFLVEAIPSFVLAFVVLRYLDNNVDEAKWLTVEEKHIVQTDLAKDRANRDRAA
NGKASHSLKEMLANRYVWLLALIFFSFNVGYYGVSFWLPSIIKTSGISDDLQIGLLAALP
YVFGAAFMIWNSRHSDLKQERRWHIAIPAVIGCIGLTLSAYCSGSTFWMMTWICVAMSGT
LALIPTYISLPGTLLSGTAAAAGIALVNSVGNLAGFFGPTVLGWLKDQTGQTDSGLYILA
GFLLLCAPLIFMLPAKLVSPGKTHGMHDQDVAQPDAEDPLNITERF