Protein Info for IAI46_03095 in Serratia liquefaciens MT49

Annotation: 30S ribosomal protein S20

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00029: ribosomal protein bS20
  • amino acids 1 to 85 (85 residues), 103.2 bits, E=4.2e-34
• PF01649: Ribosomal_S20p
  • amino acids 2 to 84 (83 residues), 104 bits, E=2.8e-34

Best Hits

Swiss-Prot: 100% identical to RS20_SERP5: 30S ribosomal protein S20 (rpsT) from Serratia proteamaculans (strain 568)

KEGG orthology group: K02968, small subunit ribosomal protein S20 (inferred from 100% identity to spe:Spro_0696)

MetaCyc: 79% identical to 30S ribosomal subunit protein S20 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S20p" in subsystem Ribosome SSU bacterial

Protein Sequence (86 amino acids)

>IAI46_03095 30S ribosomal protein S20 (Serratia liquefaciens MT49)
MANIKSAKKRAVQSEKRRKHNASGRSMMRTYIKKVEAAIATGDKEAAQAAYAVMKPIVDR
KAAKGLIHKNKAARHKSNLSARINAL