Protein Info for IAI46_03085 in Serratia liquefaciens MT49

Annotation: Na+/H+ antiporter NhaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 59 to 77 (19 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 181 to 199 (19 residues), see Phobius details amino acids 208 to 237 (30 residues), see Phobius details amino acids 257 to 275 (19 residues), see Phobius details amino acids 281 to 281 (1 residues), see Phobius details amino acids 283 to 316 (34 residues), see Phobius details amino acids 328 to 351 (24 residues), see Phobius details amino acids 362 to 380 (19 residues), see Phobius details PF06965: Na_H_antiport_1" amino acids 7 to 380 (374 residues), 497.9 bits, see alignment E=8.9e-154 TIGR00773: Na+/H+ antiporter NhaA" amino acids 8 to 380 (373 residues), 572 bits, see alignment E=2.8e-176

Best Hits

Swiss-Prot: 99% identical to NHAA_SERP5: Na(+)/H(+) antiporter NhaA (nhaA) from Serratia proteamaculans (strain 568)

KEGG orthology group: K03313, Na+:H+ antiporter, NhaA family (inferred from 98% identity to spe:Spro_0694)

MetaCyc: 67% identical to Na+:H+ antiporter NhaA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-129; TRANS-RXN-292

Predicted SEED Role

"Na+/H+ antiporter NhaA type" in subsystem Na(+) H(+) antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (388 amino acids)

>IAI46_03085 Na+/H+ antiporter NhaA (Serratia liquefaciens MT49)
MTNIIRQFLRQEAAGGIILIVAAIIALIMANTPAQGIYHAFLNLPVMVKVSSLEIAKPLL
LWINDGLMAIFFLVVGLEVKRELMQGSLAGRDKAVFPAIAALGGMLAPALIYLMFNGADE
VTRQGWAIPAATDIAFALGVMALLGNRVPTSLKVFLLALAIIDDLGVIVIIALFYTHEVS
MAALGVAAAAVAVLAFMNWRGVGKTSLYMIVGLVLWVAILKSGVHATLAGVIVGFMIPLN
VKKGPSPSETLEHELHPWVAFMILPLFAFANAGVSLQGVSLSGLTSLLPVGIAAGLFIGK
PLGIFTFSLLAVKLGIARLPEGIGFKQVFAVSVLCGIGFTMSIFIASLAFGDADVVLSTY
SRLGILIGSTTAAVVGYALLRMSLPRVR