Protein Info for IAI46_03080 in Serratia liquefaciens MT49

Annotation: molecular chaperone DnaJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00226: DnaJ
  • amino acids 5 to 66 (62 residues), 95.5 bits, E=2.4e-31
• TIGR02349: chaperone protein DnaJ
  • amino acids 5 to 346 (342 residues), 476.5 bits, E=3.2e-147
• PF01556: DnaJ_C
  • amino acids 117 to 330 (214 residues), 187.4 bits, E=2.6e-59
• PF00684: DnaJ_CXXCXGXG
  • amino acids 144 to 204 (61 residues), 65.7 bits, E=5.3e-22

Best Hits

Swiss-Prot: 98% identical to DNAJ_SERP5: Chaperone protein DnaJ (dnaJ) from Serratia proteamaculans (strain 568)

KEGG orthology group: K03686, molecular chaperone DnaJ (inferred from 98% identity to spe:Spro_0693)

MetaCyc: 89% identical to chaperone protein DnaJ (Escherichia coli K-12 substr. MG1655)
1.8.4.-

Predicted SEED Role

"Chaperone protein DnaJ" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Protein Sequence (376 amino acids)

>IAI46_03080 molecular chaperone DnaJ (Serratia liquefaciens MT49)
MAKKDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQDQDAEARFKEVKEAYEVLTDDQ
KRAAYDQYGHAAFEQGGMGGGGGFGGGGADFSDIFGDVFGDIFGGGRRQRASRGSDLRYN
MELSLEEAVRGVTKEIRIPTLEECGVCHGSGAKPGSSPVTCPTCHGQGQVQMRQGFFTVQ
QACPHCHGRGQIIKDPCNSCHGHGRVEKAKTLSVKIPAGVDTGDRIRLAGEGEAGEHGAP
AGDLYVQVQVKAHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDGRVKLKVPTETQTG
KLFRMRGKGVKSVRGGSQGDLLCRVVVETPVNLNDKQKQLLKELEESLGGPSGDKNSPRS
KSFFDGVKKFFDDLTR