Protein Info for IAI46_03065 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 17 to 40 (24 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 90 to 113 (24 residues), see Phobius details amino acids 119 to 143 (25 residues), see Phobius details amino acids 154 to 177 (24 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 244 to 268 (25 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details amino acids 310 to 329 (20 residues), see Phobius details amino acids 335 to 357 (23 residues), see Phobius details amino acids 372 to 393 (22 residues), see Phobius details amino acids 400 to 418 (19 residues), see Phobius details PF00083: Sugar_tr" amino acids 18 to 230 (213 residues), 73.3 bits, see alignment E=2e-24 PF07690: MFS_1" amino acids 34 to 386 (353 residues), 101.4 bits, see alignment E=5.2e-33 amino acids 250 to 420 (171 residues), 33.5 bits, see alignment E=2.3e-12

Best Hits

KEGG orthology group: None (inferred from 98% identity to spe:Spro_0690)

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>IAI46_03065 MFS transporter (Serratia liquefaciens MT49)
MPHDNNRRLNRQDYKTLTLAALGGALEFYDFIIFVFFAAVMGELFFPADMPEWLRQVQTF
GIFAAGYLARPLGGIVMAHFGDLVGRKKMFSLSILLMALPTLGMGLLPTYASIGIAAPLL
LLLMRVLQGAAIGGEVPGAWVFVAEHVPRRRIGFACGTLTAGLTVGILLGSLVATVINTT
LSQQTIAEGGWRIPFLLGGIFGLVAMYLRRWLQETPIFIEMQARKALAEELPLKSVVLNH
RKEVVVSMLLTWLLSAGIVVVILMTPTYLQKQFGIAPALSLQANSIATIMLIAGCITAGL
AADRFGASKTFIVGSLLLAGCSWLFYRTVGEHPEMLFACYALVGFSVGVVGAVPYVMVRA
FPAEVRFTGISFSYNVAYAIFGGLTPIFVTLIMKLTSLAPAYYVLALSGIGLLLGIYLHR
DLNSETRAQRAGSYS