Protein Info for IAI46_03050 in Serratia liquefaciens MT49

Annotation: sodium:alanine symporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 91 to 116 (26 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details amino acids 300 to 322 (23 residues), see Phobius details amino acids 349 to 372 (24 residues), see Phobius details amino acids 384 to 405 (22 residues), see Phobius details amino acids 416 to 436 (21 residues), see Phobius details TIGR00835: amino acid carrier protein" amino acids 13 to 442 (430 residues), 530 bits, see alignment E=2.1e-163 PF01235: Na_Ala_symp" amino acids 47 to 453 (407 residues), 541.6 bits, see alignment E=1.5e-166 PF03845: Spore_permease" amino acids 58 to 225 (168 residues), 25.1 bits, see alignment E=7.9e-10

Best Hits

Swiss-Prot: 51% identical to GLNT_BACSU: Probable sodium/glutamine symporter GlnT (glnT) from Bacillus subtilis (strain 168)

KEGG orthology group: K03310, alanine or glycine:cation symporter, AGCS family (inferred from 95% identity to spe:Spro_0687)

Predicted SEED Role

"Sodium/alanine symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (474 amino acids)

>IAI46_03050 sodium:alanine symporter family protein (Serratia liquefaciens MT49)
MTDLMNFINNILWGSVLIYLLLGAGIYFTLRTRFIQVRHFSHMFSVLKHSNKSDSAGISS
FQALCTTLAARVGTGNLTGVAIALTAGGPGAIFWMWVVAFIGMATSFVESSLAQLYKTKD
DQGNFRGGPAYYMEKGLGMRWMGVLFSIFLIVAFGLVFNAVQANSIAQASAVAFNVKPLY
IGIGLVVLSSLVIFGGIRSVARVAEWVVPLMAAAYLLLAFWVIGQNIEHMPAILSLVFKS
AFGLQEAAAGAVGYGISQAMTQGVQRGLFSNEAGMGSAPNAAASASPYPPHPASQGYVQM
LGVFIDTIVICSATAAIILSSGVLDQPIANVSGIDMTQRALSTAVGSWGSPFVAIAIFFF
AFTSIIANYAYAESNLVFLERNHPAGLLVFRCAALGMVMFGALAELPVVWKMADTSMALM
AITNLTAILLLSKVALKLANDYHRQRTLGKLPTFDANRFPELKSQLEPGVWDKN