Protein Info for IAI46_02995 in Serratia liquefaciens MT49

Annotation: inosine/xanthosine triphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01931: NTPase_I-T
  • amino acids 7 to 165 (159 residues), 164.5 bits, E=9.3e-53
• TIGR00258: inosine/xanthosine triphosphatase
  • amino acids 7 to 168 (162 residues), 157.1 bits, E=2.3e-50

Best Hits

Swiss-Prot: 97% identical to NCPP_SERP5: Inosine/xanthosine triphosphatase (Spro_0677) from Serratia proteamaculans (strain 568)

KEGG orthology group: None (inferred from 97% identity to spe:Spro_0677)

MetaCyc: 57% identical to inosine/xanthosine triphosphatase (Escherichia coli K-12 substr. MG1655)
RXN0-5073 [EC: 3.6.1.73]; 3.6.1.73 [EC: 3.6.1.73]

Predicted SEED Role

"Inosine/xanthosine triphosphatase (EC 3.6.1.-)" (EC 3.6.1.-)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.- or 3.6.1.73

Protein Sequence (179 amino acids)

>IAI46_02995 inosine/xanthosine triphosphatase (Serratia liquefaciens MT49)
MYHVVAATTNPAKIKAIQLAFEDTFGVDQCRIESVDVASGVSLQPIGNLETRTGARQRVM
EARQVRPEADFWVGVEAGIEENMTFAWMTVENPYTRGESRSASLMLPETILQGIRAGREL
GTEMAAITGNAEVKRQGGAIGIFTDGRLSRTSVYHQALLLALVPFHNPIYQNHNNAPQK