Protein Info for IAI46_02985 in Serratia liquefaciens MT49

Annotation: murein transglycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 642 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF14718: SLT_L" amino acids 406 to 469 (64 residues), 84.4 bits, see alignment E=5e-28 PF01464: SLT" amino acids 481 to 592 (112 residues), 117.1 bits, see alignment E=3.2e-38

Best Hits

Swiss-Prot: 64% identical to SLT_ECO57: Soluble lytic murein transglycosylase (slt) from Escherichia coli O157:H7

KEGG orthology group: K08309, soluble lytic murein transglycosylase [EC: 3.2.1.-] (inferred from 97% identity to spe:Spro_0675)

MetaCyc: 64% identical to soluble lytic murein transglycosylase (Escherichia coli K-12 substr. MG1655)
4.2.2.f [EC: 4.2.2.f]; 4.2.2.f [EC: 4.2.2.f]

Predicted SEED Role

"Soluble lytic murein transglycosylase precursor (EC 3.2.1.-)" (EC 3.2.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.- or 4.2.2.f

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (642 amino acids)

>IAI46_02985 murein transglycosylase (Serratia liquefaciens MT49)
MVKVDKWRFLAVGLCLTAFSGAALADSLDAQRQRYLQIKQAWDSKQMDVVAQLMPTLRDY
PLYPYLEYRELTQDLSQAGFSEVNDFIKQHPTLPPAKSLAPRFVNELARREDWRTLLAFS
PQAPKPIAARCNYYYAKWATGDQQAAWSGAEDVWMSGKSLPGSCDKLFSVWKGSGKQTPS
AILERMKLALKEGNSGLVNSLYRQLPSDYQTMGDALVRLQNDPATVESFARSVGPTDFTR
AATGIAFERLARQDVENARAMIPTLVRLQKMSDSEQLGLEEAVAWRLMGSDATFEQTQWR
DKVILRSQSPALLERRVRMALGNGDRQGVATWLARLPAESRNKDEWRYWRASLLLDEGKR
SEGEEILRRLMNERGFYPMVAAQKLNKPYPVMVAVAAKPRASLVDGPEIARVRELMYWNM
DNLARSEWTSFVSSRSRPEQEALARYAFEQKWADLSVQATIVGKLWDHLEERFPVAWPQE
FRAATDDKGITPSYAMAIARQESAWNPKAQSPVGASGLMQVMPRTAQHTVQMYNIPGYSS
PSQLLDPRVNITIGTSYLEYVYQQFGRNRILSSAAYNAGPSRVNTWLGNSEGRVDAVAFV
ESIPFSETRSYVKNVLAYDAFYRYLMHRPAKVLTDAEWQRRY