Protein Info for IAI46_02820 in Serratia liquefaciens MT49

Annotation: L-fucose:H+ symporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 113 to 136 (24 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 236 to 260 (25 residues), see Phobius details amino acids 272 to 290 (19 residues), see Phobius details amino acids 301 to 320 (20 residues), see Phobius details amino acids 326 to 348 (23 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details amino acids 386 to 404 (19 residues), see Phobius details TIGR00885: L-fucose:H+ symporter permease" amino acids 24 to 404 (381 residues), 325.5 bits, see alignment E=5.8e-101 PF07690: MFS_1" amino acids 30 to 370 (341 residues), 112.5 bits, see alignment E=1.1e-36 TIGR01272: glucose/galactose transporter WARNING" amino acids 104 to 402 (299 residues), 203.1 bits, see alignment E=7.4e-64

Best Hits

KEGG orthology group: K02429, MFS transporter, FHS family, L-fucose permease (inferred from 95% identity to spe:Spro_0644)

Predicted SEED Role

"Fucose permease" in subsystem L-fucose utilization or L-fucose utilization temp

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (409 amino acids)

>IAI46_02820 L-fucose:H+ symporter permease (Serratia liquefaciens MT49)
MLAEKSAAPPQLGVKSTANLRWAFILVTSLFFMWGLSYGLLDVLNKHFQETLHVTKAQSG
LLQAAYFGAYFLVALPAGYFMDKKGYKAGILVGLCLYALGALLFVPAASANSFAMFLFAL
FVIACGLGCLETAANPYATVLGDAKGAERRLNLSQSFNGLGQFIGPMIGGTLFFSATQGA
SSGDQSAVKMTYVAIAVLVLLIAFLFGRTRLPDIREEEQPEHGEIAQGLWQHKHFVGGVI
TQFFYVAAQVGVGAFFINYATEHWNEVSNQSASYLLSIAMICFMVGRFFSTWLMGRVKPA
TLLMIYSLINIALCGVVMLSLDGVSVVALIAVFFFMSIMFPTIFALGVKNMGKHTKRASS
FMIMAIVGGAIMPYFMGALADKYSTALSYVLPLLCFGVVFVYGLQQRRR