Protein Info for IAI46_02740 in Serratia liquefaciens MT49

Annotation: 3,4-dihydroxyphenylacetate 2,3-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 TIGR02295: 3,4-dihydroxyphenylacetate 2,3-dioxygenase" amino acids 14 to 309 (296 residues), 422.1 bits, see alignment E=5.6e-131 PF00903: Glyoxalase" amino acids 20 to 127 (108 residues), 31 bits, see alignment E=4.6e-11 amino acids 152 to 268 (117 residues), 48.4 bits, see alignment E=1.9e-16

Best Hits

KEGG orthology group: None (inferred from 98% identity to srr:SerAS9_0564)

Predicted SEED Role

"3,4-dihydroxyphenylacetate 2,3-dioxygenase (EC 1.13.11.15)" in subsystem 4-Hydroxyphenylacetic acid catabolic pathway or Aromatic Amin Catabolism or Aromatic amino acid degradation or Central meta-cleavage pathway of aromatic compound degradation (EC 1.13.11.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>IAI46_02740 3,4-dihydroxyphenylacetate 2,3-dioxygenase (Serratia liquefaciens MT49)
MTTKLTTDAVPAPDVVRCAYMEIQVTNLKAAREFYVDILGLVVTAEDEKTLYLRSMEEFI
HHNLVLREGPVAAVAAFAFRVRTPEDVDRAEAYFKALGCRTERRVNGFAKGIGDSVRVED
PLGFPYEFFYDVQHVERLAWRYDLYTPGALVRLDHFNQITPDVPRAVEYIQGLGFRVTED
IRDENGVVYAAWMRRKATVHDTAMTGGAGPRMHHIAFATHEKHNILAICDKLGALRKSDL
IERGPGRHGVSNAFYLYLRDPDGHRVEIYTQDYYTGDPDNPTVSWDVHDNQRRDWWGNPV
VPSWYTEGSLVLDLDGQPQPVIERNAPSEMAVTIGADGFSYTRQGDTEKGFKLGNTL