Protein Info for IAI46_02725 in Serratia liquefaciens MT49

Annotation: fumarylacetoacetate hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 TIGR02305: 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase, N-terminal subunit" amino acids 3 to 203 (201 residues), 264.6 bits, see alignment E=2.6e-83 PF01557: FAA_hydrolase" amino acids 4 to 204 (201 residues), 152.5 bits, see alignment E=7.3e-49

Best Hits

KEGG orthology group: K05921, 5-oxopent-3-ene-1,2,5-tricarboxylate decarboxylase / 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase [EC: 4.1.1.68 5.3.3.-] (inferred from 95% identity to spe:Spro_0625)

Predicted SEED Role

"5-carboxymethyl-2-oxo-hex-3- ene-1,7-dioate decarboxylase (EC 4.1.1.68) / 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase (EC 5.3.3.-)" in subsystem 4-Hydroxyphenylacetic acid catabolic pathway or Aromatic amino acid degradation (EC 4.1.1.68, EC 5.3.3.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.68, 5.3.3.-

Use Curated BLAST to search for 4.1.1.68 or 5.3.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (210 amino acids)

>IAI46_02725 fumarylacetoacetate hydrolase family protein (Serratia liquefaciens MT49)
MKGTVFSVALNHRSQIDAWDQAFHQPPYKTPPKTPVWFIKPRNTHLANGGAIPFPAGEQV
QSGATLAVVIGNTARKVPAERVADYLAGYALANDISLPESSFYRPAIKAKCRDGFCPLGE
IGSLVTTDAVEIITEINGVEQDRWSTADLVRSVPELIAAISDFITLQPGDAVLIGTPHQR
VEIKPGDEVRVRAAGLPTLTNRVVQAGETA