Protein Info for IAI46_02635 in Serratia liquefaciens MT49

Annotation: APC family permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 transmembrane" amino acids 16 to 41 (26 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 87 to 111 (25 residues), see Phobius details amino acids 129 to 147 (19 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 194 to 216 (23 residues), see Phobius details amino acids 235 to 259 (25 residues), see Phobius details amino acids 285 to 308 (24 residues), see Phobius details amino acids 337 to 356 (20 residues), see Phobius details amino acids 363 to 383 (21 residues), see Phobius details amino acids 395 to 420 (26 residues), see Phobius details amino acids 426 to 442 (17 residues), see Phobius details PF13520: AA_permease_2" amino acids 14 to 430 (417 residues), 117 bits, see alignment E=1.1e-37 PF00324: AA_permease" amino acids 18 to 426 (409 residues), 50.6 bits, see alignment E=1.4e-17

Best Hits

KEGG orthology group: None (inferred from 53% identity to pfs:PFLU3148)

Predicted SEED Role

"probable amino acid permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (458 amino acids)

>IAI46_02635 APC family permease (Serratia liquefaciens MT49)
MTEPTPEHKFKGNLSVLDVVMITASGVTPASSIFVIAPLAIASAGSGAFISFLIAAFIAA
TIALCYAELGAAHPSAGGEYSIIKRLFGTLCGLQTYLFILSAALFVPAVLATGAVPYLNT
ALGTQFDTSTAGMITILIGGACAIFNIKANALLTGTFLVVEIAVLGLIAWLGFSAPHQSA
DILVAPVMLNPEGVLAPVSVPLIVAMVGVALFSYNGYGAAVYMAEDMREQGKPMATAIML
TLAIVVLVELLPFTALLIGAPSLAEMAKQADPVGYVVSQLGGPTLARVVSGAIYLSVFNA
IIAIVAQFSRMMFSSGRDGFWLPQVNRALKIIHPRFGTPWIATLLFGIPSALLAFCSNLG
DLTSFTVILLLLVYIIMAVAALISRRRVRFHHPYLMPLWPLPVAIALIGCLYVLWTILIA
SSLKDFIIIAGILCFGLLLSYMRTRQAIPHVEPSIEGE