Protein Info for IAI46_02530 in Serratia liquefaciens MT49

Annotation: acetylornithine deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 TIGR01892: acetylornithine deacetylase (ArgE)" amino acids 8 to 376 (369 residues), 392.9 bits, see alignment E=6.9e-122 PF01546: Peptidase_M20" amino acids 67 to 376 (310 residues), 120.8 bits, see alignment E=7.8e-39 PF07687: M20_dimer" amino acids 171 to 280 (110 residues), 93.2 bits, see alignment E=9.7e-31

Best Hits

KEGG orthology group: None (inferred from 73% identity to eae:EAE_03350)

Predicted SEED Role

"Acetylornithine deacetylase (EC 3.5.1.16)" in subsystem Arginine Biosynthesis extended (EC 3.5.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.16

Use Curated BLAST to search for 3.5.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>IAI46_02530 acetylornithine deacetylase (Serratia liquefaciens MT49)
MSDAVRNLLAKLLAFDTTSQNSNLELIAFIKDYLVGFGMETQLFQDDVARKANLYARIGP
AGEGGVMLSGHTDVVPVDGQQWTVPPFVLTHHKGRYYGRGSADMKGFLACVLASVPAFVA
QPLRMPLHLAFSYDEEVGCAGVRSLVAHLKVSPDKPAMCIVGEPTGMQPVYGHKGKLAMR
CKVQGHACHSAYTPQGVNAIEYAAKLINKLTLLGSQLAATQNRCFDPPYSTLQVGTIQGG
AALNIVPQDCQFDFEIRHLPDMQVDSVISELQQYADDELLPAMREVAASSDISFQPLSHY
PGLLTDPQSDFARWLAQWSNDQAFTTVAFGTEGGLFEQAGVATLICGPGSMEQGHKPDEY
VSVEQLERCMQMLANLRLWMLA