Protein Info for IAI46_02325 in Serratia liquefaciens MT49

Annotation: ribonuclease E inhibitor RraB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 PF06877: RraB" amino acids 12 to 113 (102 residues), 108.1 bits, see alignment E=1.6e-35

Best Hits

Swiss-Prot: 77% identical to RRAB_ECOLI: Regulator of ribonuclease activity B (rraB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 93% identity to srr:SerAS9_0489)

Predicted SEED Role

"Ribonuclease E inhibitor RraB" in subsystem RNA processing and degradation, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (142 amino acids)

>IAI46_02325 ribonuclease E inhibitor RraB (Serratia liquefaciens MT49)
MANREQLEEQREETRLIIEELLEDGSDPEALYTIEHHLSAEKFEVLEQAAVEAFKLGYEV
TDAEELEVEDGTLVMCCDVISEIGLNAELIDTQVEQLVALAARCGVNYDGWGTYFEDPNG
EEGDDDEEEGDFIDEDDDGKRH