Protein Info for IAI46_02280 in Serratia liquefaciens MT49

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details transmembrane" amino acids 65 to 82 (18 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 119 to 141 (23 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 192 to 214 (23 residues), see Phobius details amino acids 243 to 268 (26 residues), see Phobius details amino acids 283 to 301 (19 residues), see Phobius details amino acids 312 to 331 (20 residues), see Phobius details PF01032: FecCD" amino acids 17 to 331 (315 residues), 284.4 bits, see alignment E=9.8e-89 PF00950: ABC-3" amino acids 122 to 313 (192 residues), 21.5 bits, see alignment E=1.5e-08

Best Hits

Swiss-Prot: 36% identical to YFME_BACSU: Fe(3+)-citrate import system permease protein YfmE (yfmE) from Bacillus subtilis (strain 168)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 92% identity to spe:Spro_0546)

Predicted SEED Role

"ABC transporter (iron.B12.siderophore.hemin) , permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>IAI46_02280 iron ABC transporter permease (Serratia liquefaciens MT49)
MSEKIRFRLAWTLAPLLLAGLIFANVAQGSVSLSLAQVLSALGIGPGDVPPMIKSIVLEL
RLPRTLLGLLAGAGLALVGALLQTTTRNDLADPFLFGLSSGASAGVVLVMTRLGDSLGAW
TLPVSSFAGGMLSAAVVLVIFMTQSQKGTEKLIICGLAVSFLFGAFTNYLVFSGDQRTAS
SVLFWTLGGLGLARWDNVIFALIALLLLVVLIALRWRSLDGLLAGEQTAGTLGINTRRLR
TEVFLCCSLATALLVALTGVIGFVGLMVPHLARPFTGVRHRRLLPLVGVLGAILLSAGDL
LSRVITAPQELPIGIITAGLGGVFVLVILLRRAH