Protein Info for IAI46_02145 in Serratia liquefaciens MT49

Annotation: NAD(P)H-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 PF02525: Flavodoxin_2" amino acids 3 to 169 (167 residues), 161.9 bits, see alignment E=1.6e-51 PF03358: FMN_red" amino acids 45 to 115 (71 residues), 24.9 bits, see alignment E=1.3e-09

Best Hits

Swiss-Prot: 46% identical to GS14_BACSU: General stress protein 14 (ywrO) from Bacillus subtilis (strain 168)

KEGG orthology group: K00358, [EC: 1.6.99.-] (inferred from 94% identity to spe:Spro_0527)

Predicted SEED Role

"Glutathione-regulated potassium-efflux system ancillary protein KefG" in subsystem Glutathione-regulated potassium-efflux system and associated functions or Potassium homeostasis

Isozymes

Compare fitness of predicted isozymes for: 1.6.99.-

Use Curated BLAST to search for 1.6.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (174 amino acids)

>IAI46_02145 NAD(P)H-dependent oxidoreductase (Serratia liquefaciens MT49)
MSRILVLTAHRFPDESRINKALIEALRPLPDVTVHELMRAYPDYQIDVAREQELLQNHDA
VVMLFPFYWYSSPAILSEWQDAVLTHGFAYGSEGTQLHGKPLQLVVTTGGNQQAYTAEGY
NRYPVEDLLRPFHAMANLTGMDYLPPHLVQGVFDMSDERLAQEAARVVALLKKE