Protein Info for IAI46_02100 in Serratia liquefaciens MT49

Annotation: phosphonate C-P lyase system protein PhnH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05845: PhnH
  • amino acids 5 to 191 (187 residues), 190.9 bits, E=1e-60
• TIGR03292: phosphonate C-P lyase system protein PhnH
  • amino acids 6 to 189 (184 residues), 175.7 bits, E=4.3e-56

Best Hits

Swiss-Prot: 50% identical to PHNH_ECOLI: Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnH (phnH) from Escherichia coli (strain K12)

KEGG orthology group: K06165, PhnH protein (inferred from 83% identity to spe:Spro_0520)

MetaCyc: 50% identical to carbon-phosphorus lyase core complex subunit PhnH (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"PhnH protein" in subsystem Alkylphosphonate utilization

Protein Sequence (193 amino acids)

>IAI46_02100 phosphonate C-P lyase system protein PhnH (Serratia liquefaciens MT49)
MSILTGFTQPIDQSQQTFRLILKALSEPGHVVTLQGGPTWDRLNAASTAALLTLADQETP
IQLSPELKSEQALTNIRFHSGAPLADRAEEVCFALFDSQLQATDLQALPRGSEISPEFSA
TVIVQLASLEQGTALRLTGPGIEHQRIISPQLPPALLDYLLNRPQRFPLGLDFLLTCGEC
LLALPRTTHVEVC