Protein Info for IAI46_02060 in Serratia liquefaciens MT49

Annotation: phosphonate metabolism protein PhnP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03307: phosphonate metabolism protein PhnP
  • amino acids 1 to 246 (246 residues), 403 bits, E=2.2e-125
• PF12706: Lactamase_B_2
  • amino acids 63 to 221 (159 residues), 70.7 bits, E=7e-24

Best Hits

Swiss-Prot: 56% identical to PHNP_ECOLI: Phosphoribosyl 1,2-cyclic phosphate phosphodiesterase (phnP) from Escherichia coli (strain K12)

KEGG orthology group: K06167, PhnP protein (inferred from 93% identity to spe:Spro_0512)

MetaCyc: 56% identical to 5-phospho-alpha-D-ribosyl 1,2-cyclic phosphate phosphodiesterase (Escherichia coli K-12 substr. MG1655)
RXN0-6710 [EC: 3.1.4.55]

Predicted SEED Role

"Metal-dependent hydrolases of the beta-lactamase superfamily I; PhnP protein"

MetaCyc Pathways

• methylphosphonate degradation I (5/5 steps found)
• (aminomethyl)phosphonate degradation (7/8 steps found)
• glyphosate degradation III (4/7 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.4.55

Protein Sequence (260 amino acids)

>IAI46_02060 phosphonate metabolism protein PhnP (Serratia liquefaciens MT49)
MQLTFLGTGGAQQIPVFGCDCLVCQRARREPAFRRRPCSAMLKFQGETTLLDAGLPSLER
RFSAGEIQRFLLTHYHMDHVQGLFPLRWGCGNFIPVYGPADEQGCDDLFKHPGILAFQPP
LTPFEPLELGGLRITPLPLQHSKITLGYLIQAAGASLAYLTDTVGLPPDTDAFLRGVPLD
LLVLDCSLPPQPQAPRNHNDLTHAQEIQQRLQPGRTLLTHISHHLDLWLTDNELPPGLEL
AFDNLSVHCGNNAPDRIPAP