Protein Info for IAI46_02035 in Serratia liquefaciens MT49

Annotation: putrescine-ornithine antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 39 to 59 (21 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 117 to 139 (23 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 222 to 247 (26 residues), see Phobius details amino acids 275 to 299 (25 residues), see Phobius details amino acids 320 to 342 (23 residues), see Phobius details amino acids 350 to 373 (24 residues), see Phobius details amino acids 385 to 403 (19 residues), see Phobius details amino acids 409 to 427 (19 residues), see Phobius details TIGR00905: transporter, basic amino acid/polyamine antiporter (APA) family" amino acids 1 to 429 (429 residues), 475.6 bits, see alignment E=1.8e-146 TIGR04299: putrescine-ornithine antiporter" amino acids 5 to 432 (428 residues), 794 bits, see alignment E=4.1e-243 PF13520: AA_permease_2" amino acids 9 to 403 (395 residues), 160 bits, see alignment E=9.6e-51 PF00324: AA_permease" amino acids 29 to 402 (374 residues), 74.9 bits, see alignment E=5.8e-25

Best Hits

Swiss-Prot: 84% identical to POTE_ECOLI: Putrescine transporter PotE (potE) from Escherichia coli (strain K12)

KEGG orthology group: K03756, putrescine:ornithine antiporter (inferred from 98% identity to spe:Spro_0508)

MetaCyc: 84% identical to putrescine transporter PotE (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-69; TRANS-RXN0-211

Predicted SEED Role

"Putrescine/proton symporter, putrescine/ornithine antiporter PotE" in subsystem Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (438 amino acids)

>IAI46_02035 putrescine-ornithine antiporter (Serratia liquefaciens MT49)
MSKSNNKMGVVQLTILTAVNMMGSGIIMLPTKLAEVGTISIVSWLVTAVGSMALAYAFAK
CGMFSRKSGGMGGYAEYAFGKSGNFMANYTYGVSLLIANIAIAISAVGYGTELFGANLSP
LGICIATIGVLWLATVANFGGARITGRISGITVWGVIIPVVGISIIGWHWFSGSAYVAAW
NPHQVPTFEAIGASISMTLWAFLGLESACANTDVVENPERNVPIAVLGGTLSAAVIYIVS
TNVIAGIVPNMDLANSTAPFGLAFSHMFNPTVGKIIMALMIMSCVGSLLGWQFTIAQVFK
SSADSGFFPKIFSKLSKADAPVKGMLTIVVIQSVLSLMTISPSLNKQFNVLVNLAVVTNI
IPYILSMAALIIIQKVAKVPEKKARIANIIAGIGALYSFYALYSSGEEAMMWGAIATFLG
WTLYGIVSPRFEMAGKKG