Protein Info for IAI46_01675 in Serratia liquefaciens MT49

Annotation: DUF350 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03994: DUF350
  • amino acids 13 to 65 (53 residues), 41.2 bits, E=6.9e-15
  • amino acids 78 to 130 (53 residues), 51 bits, E=6e-18

Best Hits

Swiss-Prot: 58% identical to YJFL_ECOLI: UPF0719 inner membrane protein YjfL (yjfL) from Escherichia coli (strain K12)

KEGG orthology group: K08989, putative membrane protein (inferred from 97% identity to srs:SerAS12_0380)

Predicted SEED Role

"Membrane protein with DUF350 domain"

Protein Sequence (132 amino acids)

>IAI46_01675 DUF350 domain-containing protein (Serratia liquefaciens MT49)
MDILSALAAFASYFFSGFAMVLVFLFVYTRITPHDEWALIKADNQAAAFGFVGACLGYVI
PLASAAINSVSLLDYLLWGVVALVVQLLLFAAVKIYMPRISDKIESNHVAAGIFLGGVSI
SGGVLNAACMTY