Protein Info for IAI46_01650 in Serratia liquefaciens MT49

Annotation: adenylosuccinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00709: Adenylsucc_synt
  • amino acids 6 to 424 (419 residues), 607 bits, E=8.5e-187
• TIGR00184: adenylosuccinate synthase
  • amino acids 6 to 430 (425 residues), 667.6 bits, E=3.6e-205

Best Hits

Swiss-Prot: 99% identical to PURA_SERP5: Adenylosuccinate synthetase (purA) from Serratia proteamaculans (strain 568)

KEGG orthology group: K01939, adenylosuccinate synthase [EC: 6.3.4.4] (inferred from 99% identity to spe:Spro_0436)

MetaCyc: 89% identical to adenylosuccinate synthetase (Escherichia coli K-12 substr. MG1655)
Adenylosuccinate synthase. [EC: 6.3.4.4]

Predicted SEED Role

"Adenylosuccinate synthetase (EC 6.3.4.4)" in subsystem CBSS-262719.3.peg.410 or Purine conversions (EC 6.3.4.4)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (26/26 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (7/7 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• adenosine ribonucleotides de novo biosynthesis (3/3 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Biosynthesis of alkaloids derived from histidine and purine
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.4

Protein Sequence (432 amino acids)

>IAI46_01650 adenylosuccinate synthase (Serratia liquefaciens MT49)
MGKNVVVLGTQWGDEGKGKVVDLLTERAQYVVRYQGGHNAGHTLVINGEKTVLHLIPSGI
LRENVTSIIGNGVVLAPDALMKEMGELEARGIPVRERLLLSEACPLILPYHVALDNAREK
ARGAKAIGTTGRGIGPAYEDKVARRGLRVSDLFNKETFAVKLKEIVDYHNFQLVNYYKVE
AVDYQATLDYVLSIADILTAMVVDVSELLDGARKRGDLIMFEGAQGTLLDIDHGTYPYVT
SSNTTAGGVATGSGIGPRYVDYVLGIVKAYSTRVGAGPFPTELFDETGEYLCKQGNEFGA
TTGRRRRTGWLDAVAVRRAVQINSLSGFCLTKLDVLDGLKEVKICVGYRMPDGREMTTTP
LAAEGWEGIEPIYESMPGWSDTTFGVKEHSKLPQAALDYIKRIEELTGVPVDIISTGPDR
SETMILRDPFDA