Protein Info for IAI46_01640 in Serratia liquefaciens MT49

Annotation: protease modulator HflC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR01932: HflC protein" amino acids 1 to 328 (328 residues), 459.4 bits, see alignment E=2.4e-142 PF01145: Band_7" amino acids 21 to 243 (223 residues), 132 bits, see alignment E=1.2e-42

Best Hits

Swiss-Prot: 82% identical to HFLC_ECO57: Modulator of FtsH protease HflC (hflC) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 98% identity to srr:SerAS9_0373)

MetaCyc: 82% identical to regulator of FtsH protease (Escherichia coli K-12 substr. MG1655)
3.4.24.-

Predicted SEED Role

"HflC protein" in subsystem Hfl operon

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>IAI46_01640 protease modulator HflC (Serratia liquefaciens MT49)
MRKSFVVIVLAVLVALYASLFVVQEGQRGIVLRFGKVLRDSDNKPLVYAPGLHFKIPFIE
SVKTLDARIQTMDNQADRFVTSEKKDLIVDSYLKWRISDFSRYYLATGGGDVSQAEVLLK
RKFSDRLRSEIGRLDVKDIVTDSRGKLMSDVRDALNTGTVGDDQEVTTTEADDAIASAAA
RVEKETTGNLPKVNPNSMAALGIEVIDVRIKQINLPAEVSDAIYQRMRAEREAVARRHRS
QGQEEAEKLRATADYEVTRTLAEAERTARITRGDGDAEAAKLFANAFSQDPDFYAFIRSL
RAYETSFSSNNQDVMVLSPDSDFFRYMKSPDSTRK