Protein Info for IAI46_01510 in Serratia liquefaciens MT49

Annotation: elongation factor P

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00038: translation elongation factor P
  • amino acids 4 to 187 (184 residues), 251.2 bits, E=2.7e-79
• PF08207: EFP_N
  • amino acids 5 to 61 (57 residues), 84.7 bits, E=5.4e-28
• PF01132: EFP
  • amino acids 71 to 123 (53 residues), 80.7 bits, E=9.1e-27
• PF09285: Elong-fact-P_C
  • amino acids 131 to 186 (56 residues), 86.2 bits, E=1.4e-28

Best Hits

Swiss-Prot: 100% identical to EFP_SERP5: Elongation factor P (efp) from Serratia proteamaculans (strain 568)

KEGG orthology group: K02356, elongation factor P (inferred from 100% identity to spe:Spro_0412)

MetaCyc: 82% identical to protein chain elongation factor EF-P (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Translation elongation factor P" in subsystem Translation elongation factors eukaryotic and archaeal

Protein Sequence (188 amino acids)

>IAI46_01510 elongation factor P (Serratia liquefaciens MT49)
MATYSSNDFRPGLKIMFEGEPYAIESSEFVKPGKGQAFARVKMRRLLTGTRVEKTFKSTD
SCEGADVVDTNMNYLYNDGEFYHFMHPETFEQHGVEEKTVSDAAKWLQDNAECIVTLWDG
RPIAVQPPNFIEAEITDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVVRVDTRS
GEYVSRVK