Protein Info for IAI46_01440 in Serratia liquefaciens MT49

Annotation: pentaheme c-type cytochrome TorC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02162: trimethylamine-N-oxide reductase c-type cytochrome TorC
  • amino acids 3 to 381 (379 residues), 582.7 bits, E=2e-179
• PF03264: Cytochrom_NNT
  • amino acids 11 to 184 (174 residues), 227.1 bits, E=1.8e-71

Best Hits

Swiss-Prot: 78% identical to TORC_ECOLI: Cytochrome c-type protein TorC (torC) from Escherichia coli (strain K12)

KEGG orthology group: K03532, trimethylamine-N-oxide reductase (cytochrome c) 1, cytochrome c-type subunit TorC (inferred from 84% identity to etr:ETAE_0299)

MetaCyc: 78% identical to cytochrome c menaquinol dehydrogenase TorC (Escherichia coli K-12 substr. MG1655)
RXN0-5264

Predicted SEED Role

"Cytochrome c-type protein TorC" in subsystem trimethylamine N-oxide (TMAO) reductase

MetaCyc Pathways

• NADH to trimethylamine N-oxide electron transfer (2/2 steps found)
• formate to trimethylamine N-oxide electron transfer (2/2 steps found)
• hydrogen to trimethylamine N-oxide electron transfer (1/2 steps found)

Protein Sequence (387 amino acids)

>IAI46_01440 pentaheme c-type cytochrome TorC (Serratia liquefaciens MT49)
MSKLWRKLTRPSAKWSVLALLGIGCILGLAIIIVPHAGIKLTSNTEFCVSCHAMQPVYQE
YQQSVHFKNASGVRAECRDCHIPPDIPGMLWRKLEAANDLYQNFIAHSIDTPEKFEAKRA
ELAKREWKRMKDNNSVGCRSCHNYEAMEHSKQHPEAAKQMSIAAKDNQSCVDCHKGIAHQ
LPDMSSGFRKQFEDMRLQANENSDGNTLYTLDMKPIYAAKGDKEPAGSLLPASEVKVLKR
DGDWLEVQIVGWTETEGRQRVLSLLPGKRIFVSSIRDEVQKHAQTLEKTTVAATGAEWSK
LQTTAWVQKGDLVNDIKPIWAYTSALYTGTCNQCHGAPDIAHFDANGWIGTLNGMVGFTS
LDKREERTLLKYLQMNASDTGGADQKH