Protein Info for IAI46_01430 in Serratia liquefaciens MT49

Annotation: molecular chaperone TorD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 transmembrane" amino acids 190 to 208 (19 residues), see Phobius details PF02613: Nitrate_red_del" amino acids 56 to 180 (125 residues), 87.6 bits, see alignment E=4.1e-29

Best Hits

Swiss-Prot: 50% identical to TORD_SALAR: Chaperone protein TorD (torD) from Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)

KEGG orthology group: K03533, TorA specific chaperone (inferred from 55% identity to eic:NT01EI_0298)

Predicted SEED Role

"Chaperone protein TorD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (213 amino acids)

>IAI46_01430 molecular chaperone TorD (Serratia liquefaciens MT49)
MEDNISALGHPHYACLYAWLSGSFARELSDVQIAELTSPELTAWLAIIEPLPGLTAPVTQ
FRQTVTALQQRPDAQLELAADFAGLFLMTEKSAALPYSSCYQLESSRFKQEPSAQMKALL
AQSGMAVASSFGEPEDHLALVVELLSHLNFALTEAGNERRELLELRSEALIHCLSWLPEF
NQRCLSYDKFGFYAALSGLLLALMRLDAGMPMQ