Protein Info for IAI46_01315 in Serratia liquefaciens MT49

Annotation: thiamine phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00693: thiamine-phosphate diphosphorylase
  • amino acids 22 to 204 (183 residues), 187 bits, E=1.1e-59
• PF02581: TMP-TENI
  • amino acids 22 to 191 (170 residues), 181.7 bits, E=4.3e-58

Best Hits

Swiss-Prot: 95% identical to THIE_SERP5: Thiamine-phosphate synthase (thiE) from Serratia proteamaculans (strain 568)

KEGG orthology group: K00788, thiamine-phosphate pyrophosphorylase [EC: 2.5.1.3] (inferred from 95% identity to spe:Spro_0283)

MetaCyc: 74% identical to thiamine phosphate synthase (Escherichia coli K-12 substr. MG1655)
Thiamine-phosphate diphosphorylase. [EC: 2.5.1.3]; 2.5.1.3 [EC: 2.5.1.3]; 2.5.1.3 [EC: 2.5.1.3]

Predicted SEED Role

"Thiamin-phosphate pyrophosphorylase (EC 2.5.1.3)" in subsystem Thiamin biosynthesis (EC 2.5.1.3)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis I (10/10 steps found)
• superpathway of thiamine diphosphate biosynthesis II (10/11 steps found)
• thiamine diphosphate salvage II (5/5 steps found)
• thiamine diphosphate salvage V (3/3 steps found)
• thiamine diphosphate biosynthesis I (E. coli) (2/2 steps found)
• thiamine diphosphate biosynthesis II (Bacillus) (2/2 steps found)
• thiamine diphosphate salvage IV (yeast) (5/7 steps found)
• thiamine diphosphate biosynthesis III (Staphylococcus) (1/3 steps found)
• thiamine diphosphate biosynthesis IV (eukaryotes) (1/3 steps found)
• thiamine diphosphate formation from pyrithiamine and oxythiamine (yeast) (4/8 steps found)
• superpathway of thiamine diphosphate biosynthesis III (eukaryotes) (3/7 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.3

Protein Sequence (212 amino acids)

>IAI46_01315 thiamine phosphate synthase (Serratia liquefaciens MT49)
MTDITTPFPATPHKLGLYPVVDSVEWIARLLDAGVTTIQLRIKDLPDEQVEEDIAAAIAL
GKRYNARLFINDYWQLAIKHDAYGVHLGQEDLETTDLAAIHRAGLRLGVSTHDDAELARA
IAVKPSYIALGHIFPTQTKDMPSAPQGLAELKRHILGLSDYPTVAIGGISIDRVADVLAC
GVGSVAVVSAITQAPDWRAATAQLLQLIEGKE