Protein Info for IAI46_01245 in Serratia liquefaciens MT49

Annotation: 50S ribosomal protein L1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01169: ribosomal protein uL1
  • amino acids 3 to 227 (225 residues), 353.3 bits, E=2.5e-110
• PF00687: Ribosomal_L1
  • amino acids 30 to 219 (190 residues), 229.4 bits, E=1.5e-72

Best Hits

Swiss-Prot: 100% identical to RL1_SERP5: 50S ribosomal protein L1 (rplA) from Serratia proteamaculans (strain 568)

KEGG orthology group: K02863, large subunit ribosomal protein L1 (inferred from 100% identity to spe:Spro_0274)

MetaCyc: 93% identical to 50S ribosomal subunit protein L1 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L1p (L10Ae)" in subsystem Ribosome LSU bacterial

Protein Sequence (234 amino acids)

>IAI46_01245 50S ribosomal protein L1 (Serratia liquefaciens MT49)
MAKLTKRMRVIRDKVDATKQYDITEAVALLKELATAKFVESVDVAVNLGIDARKSDQNVR
GATVLPNGTGRSVRVAVFAQGPNAEAAKAAGAELVGMEDLADLIKKGEMNFDVVIASPDA
MRVVGQLGQILGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVRYRNDKNGIIHTTIGKVDF
ESDKLKENLEALLVALKKAKPSQAKGVYIKKVSLSTTMGAGVAIDQSGLTAVAN