Protein Info for IAI46_01135 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 218 to 236 (19 residues), see Phobius details amino acids 248 to 273 (26 residues), see Phobius details amino acids 285 to 305 (21 residues), see Phobius details amino acids 312 to 335 (24 residues), see Phobius details amino acids 349 to 371 (23 residues), see Phobius details amino acids 377 to 394 (18 residues), see Phobius details PF07690: MFS_1" amino acids 24 to 367 (344 residues), 133.1 bits, see alignment E=1.1e-42 PF00083: Sugar_tr" amino acids 53 to 193 (141 residues), 35.6 bits, see alignment E=5.3e-13

Best Hits

KEGG orthology group: None (inferred from 92% identity to spe:Spro_0262)

Predicted SEED Role

"Bicyclomycin resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>IAI46_01135 MFS transporter (Serratia liquefaciens MT49)
MSKAVCAKQSGFWSLPARTMTLACLLVFMAQMATTVYLPSLPTVMQELSMTRRATELSIS
IFVIGAALPVLFWGAAADRFGRRLPLTLSLTLFISCSALLAFCSNGTQLLVLRALQGIAA
GGAAIIARIIVRDNWSGDELARRLSVLSIAFIAALGGGQFIGGLLSQYSHWQMGFVLMGL
TGLAILLLMQTLPLEAGRGAGPRPPMATAYWRILRRPGFFWPACVGGLGFATTVTLQEVS
PFIMQQGFGLNVTAFGALGLVIGVAYFTGAMAVNRTVARFGGKRLMQVGASIVAMTTVAI
MLLWWSGVLVGLSGMALFIVLYCLTIFGQAVLFPNSMAMAVSDAKEQGAYAMALCGFLQQ
CLAGIAAAGAVLLEHHGLWAAAIASSGFIAWLIVKLRM