Protein Info for IAI46_01115 in Serratia liquefaciens MT49

Annotation: 4-hydroxy-3-polyprenylbenzoate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00148: decarboxylase, UbiD family
  • amino acids 17 to 466 (450 residues), 611.4 bits, E=4.2e-188
• PF20695: UbiD_N
  • amino acids 21 to 100 (80 residues), 103.2 bits, E=9.8e-34
• PF01977: UbiD
  • amino acids 134 to 333 (200 residues), 286.1 bits, E=1.6e-89
• PF20696: UbiD_C
  • amino acids 339 to 463 (125 residues), 160.1 bits, E=3.8e-51

Best Hits

Swiss-Prot: 92% identical to UBID_YERPS: 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (ubiD) from Yersinia pseudotuberculosis serotype I (strain IP32953)

KEGG orthology group: K03182, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD [EC: 4.1.1.-] (inferred from 98% identity to spe:Spro_0258)

MetaCyc: 89% identical to 3-octaprenyl-4-hydroxybenzoate decarboxylase (Escherichia coli K-12 substr. MG1655)
3-OCTAPRENYL-4-OHBENZOATE-DECARBOX-RXN [EC: 4.1.1.98]

Predicted SEED Role

"3-polyprenyl-4-hydroxybenzoate carboxy-lyase (EC 4.1.1.-)" in subsystem Ubiquinone Biosynthesis (EC 4.1.1.-)

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (12/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (8/8 steps found)
• plastoquinol-9 biosynthesis II (1/5 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (2/8 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Fluorene degradation
• Phenylalanine metabolism
• Phenylpropanoid biosynthesis
• Purine metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.- or 4.1.1.98

Protein Sequence (506 amino acids)

>IAI46_01115 4-hydroxy-3-polyprenylbenzoate decarboxylase (Serratia liquefaciens MT49)
MPSSLAVIMISMKYRDLRDFLSLLEKRGELKRISQPIDPYLEMTEIADRTLRAGGPALLF
ENPKGYDMPVLCNLFGTANRVAMGMGQEDVSSLREVGKLLAFLKEPEPPKGFRDLFDKLP
KFKQVLNMPTKVLGSAPCQEQVWQGDDVDLSRIPVMHCWPEDAAPLITWGLTVTRGPQKE
RQNLGIYRQQVLSKNKVIMRWLSHRGGALDYQEWCQAHPGERFPVAVALGADPATILGAV
TPVPDTLSEYAFAGLLRGNKTEVVKCLSCDLEVPASAEIVLEGYIEPGEMAPEGPYGDHT
GYYNEIDHFPVFTITHITQRRDAIYHSTYTGRPPDEPAVLGVALNEVFVPILQKQFPEIV
DFYLPPEGCSYRLAVVTIKKQYAGHAKRVMMGVWSFLRQFMYTKFVIVCDDDVNARDWND
VIWAITTRMDPARDTVMVENTPIDYLDFASPVSGLGSKMGLDATNKWPGETEREWGRPIE
MDEKVRARIDDIWDELAIFSDREPTL