Protein Info for IAI46_01080 in Serratia liquefaciens MT49

Annotation: Sec-independent protein translocase subunit TatA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01411: twin arginine-targeting protein translocase, TatA/E family
  • amino acids 3 to 47 (45 residues), 70.2 bits, E=4.2e-24
• PF02416: TatA_B_E
  • amino acids 4 to 48 (45 residues), 47.1 bits, E=5.8e-17

Best Hits

Swiss-Prot: 70% identical to TATA_PROMH: Sec-independent protein translocase protein TatA (tatA) from Proteus mirabilis (strain HI4320)

KEGG orthology group: None (inferred from 99% identity to srr:SerAS9_0207)

MetaCyc: 54% identical to twin arginine protein translocation system - TatA protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-181

Predicted SEED Role

"Twin-arginine translocation protein TatA" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related or Twin-arginine translocation system

Protein Sequence (87 amino acids)

>IAI46_01080 Sec-independent protein translocase subunit TatA (Serratia liquefaciens MT49)
MGGISITQLLIIAVIVVLLFGTKKLRTLGSDLGASIKGFKKAIGDDNTPPTNTAEKSSLD
DADFTAKPITDKQPEVKAEESKNKEQV