Protein Info for IAI46_01070 in Serratia liquefaciens MT49
Annotation: SCP2 domain-containing protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 58% identical to UBIJ_SHIFL: Ubiquinone biosynthesis protein UbiJ (ubiJ) from Shigella flexneri
KEGG orthology group: K03690, hypothetical protein (inferred from 95% identity to srs:SerAS12_0205)MetaCyc: 58% identical to ubiquinone biosynthesis accessory factor UbiJ (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Protein YigP (COG3165) clustered with ubiquinone biosynthetic genes" in subsystem Ubiquinone Biosynthesis
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (202 amino acids)
>IAI46_01070 SCP2 domain-containing protein (Serratia liquefaciens MT49) MLLTPLLTGVLETSLNSLLFRDRSMKAARLRLAGKVLRIELQELASPLVLIFSEQRVDVL GQSDDTADCTVRSRISVLLKLRDRQQLSPLMRSGELIVEGDIQVVQQLVGLLDLAEWDPA EWLAPYIGDIAAQGVTQAFGKGANLLKKGLQRQQNYVAETLTEEWRVAPGPLEVVWFNEE VDATVRSAEALIARMDKLEGKR