Protein Info for IAI46_01060 in Serratia liquefaciens MT49

Annotation: DNA recombination protein RmuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 515 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 342 to 360 (19 residues), see Phobius details amino acids 375 to 393 (19 residues), see Phobius details PF02646: RmuC" amino acids 171 to 467 (297 residues), 360.5 bits, see alignment E=3e-112

Best Hits

Swiss-Prot: 84% identical to RMUC_YERPE: DNA recombination protein RmuC homolog (rmuC) from Yersinia pestis

KEGG orthology group: K09760, DNA recombination protein RmuC (inferred from 97% identity to spe:Spro_0247)

Predicted SEED Role

"DNA recombination protein RmuC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (515 amino acids)

>IAI46_01060 DNA recombination protein RmuC (Serratia liquefaciens MT49)
MDTSLVYGIGGVTVGLLLGWLIASLRVQQSNAQHETELRLLEQSLQQAQQETAARQETLL
RNEQQMRQNDLELRNLHSQLAAGHEKLQQLNHWRNECELLNQELRAQREVNSAQEAELRE
VTIRLEETRMAAEEKQRLLINSEQRLTTQFENLANRIFEHSGRKVDEQNKQSLDRLLLPL
REQLDGFRRQVQDSFGQEARERHTLTHEIRNLQQLNAQMAREAINLTKALKGDNKTQGNW
GEVVLSRVLEASGLREGHEYETQVNVRLDHQSRMQPDVIVRLPQGKDVVIDAKMSLVAYE
RYFNSEDEVEREAALSEHIASLRGHIRLLGRKDYQQLPGLRSLDYVLMFIPVEPAFLLAI
DREPELISEALKHNIMLVSPTTLLVALRTITNLWRYEHQSQNAQRIADRAARLYDKMRLF
VDDMSALGQSLDKAQGSYRQAMNKLSEGRGNLIGQTEGFRALGVEVKRPINPLLAQQASA
QHDEEFEAAGEDDIDALPGAEDDDAAEQPRSASQA