Protein Info for IAI46_01040 in Serratia liquefaciens MT49

Annotation: dienelactone hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02129: Peptidase_S15
  • amino acids 46 to 178 (133 residues), 26 bits, E=2.2e-09
• PF01738: DLH
  • amino acids 50 to 272 (223 residues), 238.6 bits, E=1.8e-74
• PF02230: Abhydrolase_2
  • amino acids 144 to 245 (102 residues), 23.2 bits, E=1.7e-08

Best Hits

Swiss-Prot: 82% identical to DLHH_YERPE: Putative carboxymethylenebutenolidase (YPO3787) from Yersinia pestis

KEGG orthology group: None (inferred from 93% identity to srr:SerAS9_0199)

Predicted SEED Role

"Putative carboxymethylenebutenolidase (EC 3.1.1.45)" (EC 3.1.1.45)

MetaCyc Pathways

• 4-chlorocatechol degradation (2/5 steps found)
• 4,5-dichlorocatechol degradation (3/7 steps found)
• 3,4,6-trichlorocatechol degradation (4/9 steps found)
• 3-chlorocatechol degradation I (ortho) (1/5 steps found)
• 3-chlorocatechol degradation II (ortho) (1/5 steps found)
• 3,5-dichlorocatechol degradation (3/8 steps found)
• 1,4-dichlorobenzene degradation (3/9 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Fluorobenzoate degradation
• gamma-Hexachlorocyclohexane degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.45

Protein Sequence (278 amino acids)

>IAI46_01040 dienelactone hydrolase family protein (Serratia liquefaciens MT49)
MKTDHVMTLKQAQGGFTPAVTPLAASTILTDEQGIHTGETTIPSQGDNLPAYIAKPADHS
GPFPVVLVVQEIFGVHEHIQDVCRRLAKQGYLAIAPELYFRQGDAREYTDISELFQNLVS
KVPDRQVLADLDHAAHWATRHGGDAGKLAITGFCWGGRISWLYAAHNPQLKAAVAWYGKL
VGEKTLNSPKHPVDVATQLTAPVLGLYGGQDSSIPLETVESMRQAIRAANANAEIVVYPE
AGHAFNADYRPSYNAEAAEDGWQRMLAWFAQHGVPGVK