Protein Info for IAI46_00935 in Serratia liquefaciens MT49

Annotation: cell division protein FtsX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 37 to 60 (24 residues), see Phobius details amino acids 179 to 206 (28 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details amino acids 288 to 308 (21 residues), see Phobius details TIGR00439: putative protein insertion permease FtsX" amino acids 19 to 316 (298 residues), 432.4 bits, see alignment E=4.5e-134 PF18075: FtsX_ECD" amino acids 75 to 169 (95 residues), 53.3 bits, see alignment E=3.6e-18 PF02687: FtsX" amino acids 192 to 306 (115 residues), 48.1 bits, see alignment E=1.1e-16

Best Hits

Swiss-Prot: 73% identical to FTSX_SHIFL: Cell division protein FtsX (ftsX) from Shigella flexneri

KEGG orthology group: K09811, cell division transport system permease protein (inferred from 99% identity to spe:Spro_0223)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>IAI46_00935 cell division protein FtsX (Serratia liquefaciens MT49)
MANNAKTAKSKALRGGWREQWRYAWMNAVKDMLRQPLATLLTVMVIAISLTLPSVCYIVW
KNVSTAATQWYPTPQLTVYLDKSLDDDAAVKVLDAIKAEAGVEKVNYLSREEARGEFRNW
SGFGGALDMLEENPLPAVAIITPKMSFQSSDTLNTLRDRVAAVQGVDEVRMDDSWFARLA
ALTGLVGQVAAMIGVLMVVAVFLVIGNSVRLSIFSRRDTINVMKLIGATDGFILRPFLNG
GAMLGFFGALLSLVLSGAMVWRLESVVTGVAKVFGTTFTLHGLGWDEALLLLIVSAMIGW
IAAWLATVQHLRRFTPQ