Protein Info for IAI46_00810 in Serratia liquefaciens MT49

Annotation: glycerol-3-phosphate dehydrogenase subunit GlpB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR03378: glycerol-3-phosphate dehydrogenase, anaerobic, B subunit" amino acids 3 to 416 (414 residues), 570.4 bits, see alignment E=1.3e-175 PF07992: Pyr_redox_2" amino acids 3 to 40 (38 residues), 27.5 bits, see alignment 6.4e-10 PF00890: FAD_binding_2" amino acids 4 to 404 (401 residues), 280.2 bits, see alignment E=1.1e-86 PF01134: GIDA" amino acids 4 to 31 (28 residues), 20.1 bits, see alignment (E = 8.9e-08) PF01266: DAO" amino acids 4 to 100 (97 residues), 30.5 bits, see alignment E=8.6e-11 PF13450: NAD_binding_8" amino acids 7 to 32 (26 residues), 21.9 bits, see alignment (E = 5.2e-08)

Best Hits

Swiss-Prot: 68% identical to GLPB_YERE8: Anaerobic glycerol-3-phosphate dehydrogenase subunit B (glpB) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K00112, glycerol-3-phosphate dehydrogenase subunit B [EC: 1.1.5.3] (inferred from 90% identity to spe:Spro_0201)

Predicted SEED Role

"Anaerobic glycerol-3-phosphate dehydrogenase subunit B (EC 1.1.5.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Respiratory dehydrogenases 1 (EC 1.1.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.5.3

Use Curated BLAST to search for 1.1.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (423 amino acids)

>IAI46_00810 glycerol-3-phosphate dehydrogenase subunit GlpB (Serratia liquefaciens MT49)
MRFDVVVIGGGLAGMACAIRLAEQGKRCAVVSSGQSALYFSSGSLDLLAQLPDGTPVTEP
LAALSALATQAPRHPYALIGAERVAALSGEAASLLQRCGLALQGDSERNHLRITPLGTRR
ATWLSPQAIPVTPLGGELPWRHIAVIGIEGFLDFQPQLAASSLTQSLGVRAEVADMHLPA
LDRLRNNPSEFRAVNIARVLDLPENLTPMADELRRLAADAEAIFLPACLGLEDDAPLAAL
QAAVGKPIRLLPTLPPSVLGMRLHQALRSRLQQLGGVFMPGDSVLRADIEAGRVTGVYTR
NHTDIPLVAQQVVLASGSFFSNGLVADFDGIREPVFGLDVDSKAERADWSCRELFAPQPY
LQFGVRTDNQLRALRQGEPLSNLYAIGAVTGGYDPLQQGCGAGVSLVGALHVAQQIAVQE
EQP