Protein Info for IAI46_00805 in Serratia liquefaciens MT49

Annotation: anaerobic glycerol-3-phosphate dehydrogenase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01494: FAD_binding_3
  • amino acids 9 to 215 (207 residues), 32.2 bits, E=2e-11
• PF00890: FAD_binding_2
  • amino acids 11 to 220 (210 residues), 32.3 bits, E=2e-11
• TIGR03377: glycerol-3-phosphate dehydrogenase, anaerobic, A subunit
  • amino acids 11 to 537 (527 residues), 871.6 bits, E=9.6e-267
• PF12831: FAD_oxidored
  • amino acids 11 to 211 (201 residues), 33.8 bits, E=7.7e-12
• PF01266: DAO
  • amino acids 11 to 360 (350 residues), 199.1 bits, E=4.8e-62
• PF13450: NAD_binding_8
  • amino acids 14 to 53 (40 residues), 22.2 bits, 4.3e-08
• PF04324: Fer2_BFD
  • amino acids 433 to 484 (52 residues), 32.1 bits, 3.5e-11

Best Hits

Swiss-Prot: 78% identical to GLPA_ECO57: Anaerobic glycerol-3-phosphate dehydrogenase subunit A (glpA) from Escherichia coli O157:H7

KEGG orthology group: K00111, glycerol-3-phosphate dehydrogenase [EC: 1.1.5.3] (inferred from 98% identity to spe:Spro_0200)

MetaCyc: 78% identical to anaerobic glycerol-3-phosphate dehydrogenase subunit A (Escherichia coli K-12 substr. MG1655)
Glycerol-3-phosphate dehydrogenase. [EC: 1.1.5.3]

Predicted SEED Role

"Anaerobic glycerol-3-phosphate dehydrogenase subunit A (EC 1.1.5.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Respiratory dehydrogenases 1 (EC 1.1.5.3)

MetaCyc Pathways

• glycerol and glycerophosphodiester degradation (4/4 steps found)
• glycerol degradation I (3/3 steps found)
• glycerol-3-phosphate shuttle (2/2 steps found)
• glycerol-3-phosphate to fumarate electron transfer (2/2 steps found)
• glycerol-3-phosphate to hydrogen peroxide electron transport (2/2 steps found)
• glycerophosphodiester degradation (2/2 steps found)
• nitrate reduction IX (dissimilatory) (2/2 steps found)
• sn-glycerol 3-phosphate anaerobic respiration (2/3 steps found)
• glycerol 3-phosphate to cytochrome aa₃ oxidase electron transfer (1/2 steps found)
• glycerol-3-phosphate to cytochrome bo oxidase electron transfer (1/2 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.5.3

Use Curated BLAST to search for 1.1.5.3

Protein Sequence (547 amino acids)

>IAI46_00805 anaerobic glycerol-3-phosphate dehydrogenase subunit A (Serratia liquefaciens MT49)
MSSHSAENETDVIIIGGGATGAGIARDCARRGLRCILLERHDIATGATGRNHGLLHSGAR
YAVTDGESARECIEENRILKRIAHHCIERTDGLFITLPQDSLAYQQQFIVSCHSAGINAE
AIDPQLALRLEPAANPALIGAVRVPDGTVDPFRLTAANMLDAREHGAQILTYHQVVGLLR
TGDRVTGVRVFDHQSSRRYDIHAEVVVNAAGIWGQQIAEYADLRIRMFPAKGALLILGHR
INNMVINRCRKPADADILVPGDTISLIGTTSTHIDYDQIDNMLVTPQEVDILIREGALLA
PELAQTRILRAYAGVRPLVASDDDPSGRNVSRGIVLLDHASRDGLEGFITITGGKLMTYR
LMAQWATDKVCEKLRVDSPCTTAQEALPGSRQSAEETVRSVVSLPASIRGSAVYRHGDRA
NRVPAGDRLDNSLVCECEAVTAGEVRYAVNSLTVNNLVDLRRRTRVGMGTCQGELCACRA
AGLLTRFNVTTPQQSIDQLSHFLNERWKGVRPIAWGDALRESEFTSWVYQGLCGLDARGE
QGADDAI