Protein Info for IAI46_00785 in Serratia liquefaciens MT49

Annotation: lysophospholipase L2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 transmembrane" amino acids 137 to 152 (16 residues), see Phobius details amino acids 161 to 176 (16 residues), see Phobius details PF12146: Hydrolase_4" amino acids 55 to 315 (261 residues), 188.3 bits, see alignment E=2.8e-59 PF00561: Abhydrolase_1" amino acids 59 to 314 (256 residues), 99.5 bits, see alignment E=4.9e-32 PF12697: Abhydrolase_6" amino acids 80 to 320 (241 residues), 46.8 bits, see alignment E=1.2e-15

Best Hits

Swiss-Prot: 63% identical to PLDB_ECOLI: Lysophospholipase L2 (pldB) from Escherichia coli (strain K12)

KEGG orthology group: K01048, lysophospholipase [EC: 3.1.1.5] (inferred from 94% identity to spe:Spro_0196)

MetaCyc: 63% identical to lysophospholipase L2 (Escherichia coli K-12 substr. MG1655)
Lysophospholipase. [EC: 3.1.1.5]; 3.1.1.5 [EC: 3.1.1.5]; RXN0-7122 [EC: 3.1.1.5]

Predicted SEED Role

"Lysophospholipase L2 (EC 3.1.1.5)" in subsystem Synechocystis experimental or Triacylglycerol metabolism (EC 3.1.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (345 amino acids)

>IAI46_00785 lysophospholipase L2 (Serratia liquefaciens MT49)
MTSFTLSTDDWLTRETQFAAFATGPLLDFWRLREEGEFIGVGGVPIRFVRFCSARHQRVV
VVSPGRIESYVKYPEVAYDLFQCGYDVMILDHRGQGRSGRLLADTHRGHVINFSDYVDDF
TQFYQQEVKPRGYRQRFALAHSMGGAILAQFLARQPQAFDAAAFCAPMFGIYLPMPGWMA
NRILDWAEKHPKVREYYAIGTGQWRPLPYVVNVLTHSRERYRRCLRYYADYPELQVGGPT
YHWVRESLQAGRDIIAQAANITTPLLLLQAGEDRVVDNRSHQAFCQALSEAGHPCEGEKP
QVIEGARHEILFERDAMRAVALNAILRFFAQHLGGTPTADHSIRG