Protein Info for IAI46_00760 in Serratia liquefaciens MT49

Annotation: thioesterase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00369: uncharacterized domain 1
  • amino acids 27 to 154 (128 residues), 58.1 bits, E=4.5e-20
• PF13622: 4HBT_3
  • amino acids 57 to 153 (97 residues), 32.5 bits, E=8.1e-12
• PF03061: 4HBT
  • amino acids 58 to 144 (87 residues), 48.6 bits, E=8.6e-17

Best Hits

Swiss-Prot: 68% identical to YIGI_ECOLI: Uncharacterized protein YigI (yigI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to spe:Spro_0191)

MetaCyc: 68% identical to acyl-CoA thioesterase YigI (Escherichia coli K-12 substr. MG1655)
Acyl-CoA hydrolase. [EC: 3.1.2.20]; Palmitoyl-CoA hydrolase. [EC: 3.1.2.20, 3.1.2.2]; 3.1.2.2 [EC: 3.1.2.20, 3.1.2.2]

Predicted SEED Role

"putative protein PaaI, possibly involved in aromatic compounds catabolism"

MetaCyc Pathways

• acyl-CoA hydrolysis (1/1 steps found)
• bacterial bioluminescence (4/8 steps found)
• stearate biosynthesis I (animals) (1/6 steps found)
• sporopollenin precursors biosynthesis (5/18 steps found)
• firefly bioluminescence (2/14 steps found)
• cutin biosynthesis (2/16 steps found)
• jasmonic acid biosynthesis (4/19 steps found)
• suberin monomers biosynthesis (3/20 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.2 or 3.1.2.20

Protein Sequence (156 amino acids)

>IAI46_00760 thioesterase family protein (Serratia liquefaciens MT49)
MSTTPLTLEAARQKIGEIFVYHMPFNRELGLELRRFDDDYVELSFTNQPKLVGNAAQKIL
HGGVIASVLDVAAGLACAGSVLMRLDPLIEEEVASRLSRMGTIDLRVDYLRPGRGEHFIA
AASVLRSGNKVAVARVELHNHDGLHIASATATYLVG