Protein Info for IAI46_00685 in Serratia liquefaciens MT49

Annotation: uroporphyrinogen-III C-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 transmembrane" amino acids 37 to 55 (19 residues), see Phobius details PF04375: HemX" amino acids 129 to 362 (234 residues), 357.8 bits, see alignment E=1.5e-111

Best Hits

Swiss-Prot: 64% identical to HEMX_ECOLI: Protein HemX (hemX) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 93% identity to srr:SerAS9_0137)

Predicted SEED Role

"Homolog of E. coli HemX protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (374 amino acids)

>IAI46_00685 uroporphyrinogen-III C-methyltransferase (Serratia liquefaciens MT49)
MTEQNTPSAPVEEPTSAVESPQQPDAEKRKGKNTGPVLGAIAIVLVIALAAGGYYHTHRQ
AQQLIAANQTLQQQLEALKQNQQQERSALEGLLQQQGKTLDAADREQATLARQLNELQEK
VAIISGSDAKTWLLAQADFLVKMAGRKLWSDQDVTTAAALLKSADASLADMNDPSLLEVR
RAITEDVSTLSTLTQVDFDGIILKTNQLSNQVDNLRLADNDSDEAPMDQDSSELSSSIGE
WRQNLAKSWHNFMADFITVRRRDSNAEPLLAPNQDIYLRENIRSRLLVAAQAIPRHQNEV
YKQSLETISTWVRAYFDTTDPATKAFLEELDALSQQSITMDVPDQLKSQPLLEKLMQTRV
RNLMAQSPAAHQEG