Protein Info for IAI46_00650 in Serratia liquefaciens MT49

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 transmembrane" amino acids 21 to 38 (18 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 95 to 121 (27 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 156 to 178 (23 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details amino acids 242 to 263 (22 residues), see Phobius details amino acids 276 to 301 (26 residues), see Phobius details amino acids 333 to 355 (23 residues), see Phobius details amino acids 361 to 387 (27 residues), see Phobius details amino acids 407 to 425 (19 residues), see Phobius details amino acids 431 to 452 (22 residues), see Phobius details PF00324: AA_permease" amino acids 18 to 452 (435 residues), 372.3 bits, see alignment E=3.5e-115 PF13520: AA_permease_2" amino acids 22 to 436 (415 residues), 132.4 bits, see alignment E=2.3e-42

Best Hits

Swiss-Prot: 83% identical to YIFK_SALTI: Probable transport protein YifK (yifK) from Salmonella typhi

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 98% identity to spe:Spro_0173)

MetaCyc: 82% identical to threonine/serine:H+ symporter ThrP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-71; TRANS-RXN-72

Predicted SEED Role

"Probable transport protein YifK"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (467 amino acids)

>IAI46_00650 amino acid permease (Serratia liquefaciens MT49)
MAHKEKPQGLHRGLEARHIELIALGGTIGVGLFMGSASTLKWAGPSVLLAYIIAGLFVFF
IMRSMGEMLFLEPVAGSFAVYAHKYMNPYFGYLTAWGYWFMWIAVGISEITAVGVYVQFW
FPEIPQWIPALIAVAMVALANLAAVRLYGELEFWFAMIKVTTIIVMILVGLGVIFFGFGN
GGQPIGFANLTEHGGFFAGGWKGFLFALCIVVASYQGVELVGITAGEAKNPQVTLKRAIN
NILWRILIFYVGAIFVIVTIFPWNGIGTAGSPFVLTFAKIGIVAAAGIINFVVLTAALSG
CNSGMYSGGRMLYALAKNRQLPASLTKLSANGVPVNCIAVTIACLLVGSGLNYLIPNPQA
VFVYVYSASVLPGMVPWFVVLISQLYFRRAHKEAIKTHSFKSIMFPYVNYLTIAFLVCVL
IGMGINPDTRISLLVGAIFLAAVSLCYFAFGMHKKHHPAEKRTETQQ