Protein Info for IAI46_00640 in Serratia liquefaciens MT49

Annotation: ECA oligosaccharide polymerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 37 to 59 (23 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 156 to 174 (19 residues), see Phobius details amino acids 181 to 199 (19 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 226 to 244 (19 residues), see Phobius details amino acids 336 to 360 (25 residues), see Phobius details amino acids 379 to 398 (20 residues), see Phobius details amino acids 404 to 429 (26 residues), see Phobius details PF06899: WzyE" amino acids 1 to 440 (440 residues), 864.6 bits, see alignment E=8.8e-265

Best Hits

Swiss-Prot: 94% identical to WZYE_SERP5: Probable ECA polymerase (wzyE) from Serratia proteamaculans (strain 568)

KEGG orthology group: K02853, 4-alpha-L-fucosyltransferase [EC: 2.4.1.-] (inferred from 94% identity to spe:Spro_0171)

Predicted SEED Role

"Putative ECA polymerase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (458 amino acids)

>IAI46_00640 ECA oligosaccharide polymerase (Serratia liquefaciens MT49)
MTLAQFGGLFIVYLVSVLFILTLAYQEFRRVRFNFNVFFTLLYLLTFYFGFPLTCLLVFQ
FDVEVVPVEFLLYAILSATAFYAIYYVSYKTRLRKRSVQPRKPVFTMNRVETHLTWMLLA
LVAMATVGIFFMQNGFLLFKLNSYSQIFSSDVSGVALKRFFYFFIPAMLVVYFLKQDLRA
WFFFLAATVAFGILTYVIVGGTRANIIIAFSLFLFIGIVRGWISLWMLVAAGVFGIVGMF
WLALKRYSLDVSGPEAFYTFLYLTRDTFSPWENLALLLQNYDKIDFQGLAPIVRDFYVFI
PAWLWPGRPDTVLNSANYFTWEVLNNHSGLAISPTLIGSLVVMGGAVFIPVGAVLVGMII
KWFDWLYEMGKSEPNRYKAAILQSFCFGAVFNIIVLAREGVDSFVSRVVFFCLIFGACLL
MAKLLYWLFDTAGLIKARVRRTHTLASTPSSVRVDGLL