Protein Info for IAI46_00605 in Serratia liquefaciens MT49

Annotation: UDP-N-acetyl-D-mannosamine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03026: nucleotide sugar dehydrogenase
  • amino acids 5 to 414 (410 residues), 396.7 bits, E=5.4e-123
• PF03446: NAD_binding_2
  • amino acids 5 to 136 (132 residues), 25.8 bits, E=2e-09
• PF03721: UDPG_MGDP_dh_N
  • amino acids 5 to 190 (186 residues), 199.1 bits, E=1e-62
• PF00984: UDPG_MGDP_dh
  • amino acids 206 to 293 (88 residues), 94.5 bits, E=7.2e-31
• PF03720: UDPG_MGDP_dh_C
  • amino acids 324 to 419 (96 residues), 71.6 bits, E=1.2e-23

Best Hits

Swiss-Prot: 91% identical to WECC_YERPE: UDP-N-acetyl-D-mannosamine dehydrogenase (wecC) from Yersinia pestis

KEGG orthology group: K02472, UDP-N-acetyl-D-mannosaminuronic acid dehydrogenase [EC: 1.1.1.-] (inferred from 98% identity to srs:SerAS12_0126)

MetaCyc: 83% identical to UDP-N-acetyl-D-mannosamine dehydrogenase (Escherichia coli K-12 substr. MG1655)
UDPMANNACADEHYDROG-RXN [EC: 1.1.1.336]

Predicted SEED Role

"UDP-glucose dehydrogenase (EC 1.1.1.22)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) or Teichuronic acid biosynthesis (EC 1.1.1.22)

MetaCyc Pathways

• superpathway of enterobacterial common antigen biosynthesis (8/10 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (5/6 steps found)
• UDP-α-D-glucuronate biosynthesis (from UDP-glucose) (1/1 steps found)
• UDP-N-acetyl-α-D-mannosaminouronate biosynthesis (1/1 steps found)
• colanic acid building blocks biosynthesis (8/11 steps found)
• UDP-α-D-xylose biosynthesis (1/2 steps found)
• UDP-sugars interconversion (2/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (7/24 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Fructose and mannose metabolism
• Glycine, serine and threonine metabolism
• Insect hormone biosynthesis
• Linoleic acid metabolism
• Nucleotide sugars metabolism
• Pentose and glucuronate interconversions
• Polyketide sugar unit biosynthesis
• Retinol metabolism
• Starch and sucrose metabolism
• Tetrachloroethene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-, 1.1.1.22

Use Curated BLAST to search for 1.1.1.- or 1.1.1.22 or 1.1.1.336

Protein Sequence (420 amino acids)

>IAI46_00605 UDP-N-acetyl-D-mannosamine dehydrogenase (Serratia liquefaciens MT49)
MSFNTISVIGLGYIGLPTAAAFASRKKKVVGVDVNQHAVDTINRGAIHIVEPDLDKVVKD
AVDGGYLQAVTKPLAADAFLIAVPTPFKGDHEPDLAYVEAAAKSLAPVLKKGDLVILEST
SPVGATEQMAQWLAEARSDLSFPQQAGEAADVNIAYCPERVLPGQVMVELIQNDRVIGGM
TPKCSERASELYKIFLEGECVITNSRTAEMCKLTENSFRDVNIAFANELSLICADQGINV
WELIRLANRHPRVNILQPGPGVGGHCIAVDPWFIVSQNPQQARLIHTARLVNDGKPLWVV
DRVKAAVADCLAATDKRASEVKIACFGLAFKPNIDDLRESPAVEVAHLIADWHVGETLVV
EPNVEQLPKSLAGHVTLKAMADALQQADVIVMLVDHKQFKAIRPEEITQSWVVDTKGVWR