Protein Info for IAI46_00580 in Serratia liquefaciens MT49

Annotation: thioredoxin TrxA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00085: Thioredoxin
  • amino acids 5 to 105 (101 residues), 117.4 bits, E=4e-38
• TIGR01068: thioredoxin
  • amino acids 9 to 107 (99 residues), 130.7 bits, E=1e-42
• PF13098: Thioredoxin_2
  • amino acids 19 to 104 (86 residues), 33.9 bits, E=5.1e-12

Best Hits

Swiss-Prot: 88% identical to THIO_ECO57: Thioredoxin 1 (trxA) from Escherichia coli O157:H7

KEGG orthology group: K03671, thioredoxin 1 (inferred from 98% identity to spe:Spro_0159)

MetaCyc: 88% identical to reduced thioredoxin 1 (Escherichia coli K-12 substr. MG1655)
RXN-20161 [EC: 1.8.4.16]

Predicted SEED Role

"Thioredoxin" in subsystem Glycine reductase, sarcosine reductase and betaine reductase

MetaCyc Pathways

• cytochrome c biogenesis (system I type) (9/11 steps found)
• periplasmic disulfide bond reduction (2/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.16

Protein Sequence (108 amino acids)

>IAI46_00580 thioredoxin TrxA (Serratia liquefaciens MT49)
MSDKIIHLTDGSFENDVLKAEGPILVDFWAEWCGPCKMIAPILDEIAEEFEGKLTITKLN
IDQNPATAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKDFLNANL