Protein Info for IAI46_00555 in Serratia liquefaciens MT49

Annotation: insulinase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00675: Peptidase_M16" amino acids 52 to 160 (109 residues), 33.7 bits, see alignment E=3.5e-12 PF05193: Peptidase_M16_C" amino acids 201 to 378 (178 residues), 74.8 bits, see alignment E=8.6e-25

Best Hits

Swiss-Prot: 61% identical to YHJJ_ECOLI: Protein YhjJ (yhjJ) from Escherichia coli (strain K12)

KEGG orthology group: K07263, zinc protease [EC: 3.4.24.-] (inferred from 97% identity to spe:Spro_0154)

Predicted SEED Role

"Protein YhjJ, putative peptidase"

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (497 amino acids)

>IAI46_00555 insulinase family protein (Serratia liquefaciens MT49)
MQGTRIHLIVGGLLLAAANSSVQAEALQPDPAWQQGALANGFSWQILDTPQRPSDRVELR
LMVNTGSLVESSQQIGFAHLLPRLSLARSESFTPPQLRSLWQQSVDPERPLPPAISSYDF
TMYNLSLPNNRPDLLKEALAWLSDTTGKLAIDEHTVHAVINSNVDPVGTFPPNPKDAWWR
YRLKGSTLLAHDPAQPPKRPVNVDQLKKFYQQWYTPDAMTLYVVGKVDSRSLGEQINKAF
SPLKGKRETPATMPTLTPLPPQPVSLISEQVKQDTLSIMWDAPWHPIRDSQNLSRYWRGD
MAREALFWHLQQVLEKSDQKNLHLGFDCRVQYQRAQCAIHLDTPNNNLNNSLGFIARELA
NVRNNGLSQDEFNALLAQKTDQLSKLFATYARTDTDVLMSQRLRSQQSGVVDIAPEQYQK
LRQEFLSGLTLEALNQELKLQLSQDATLVLMQPKGEPEMSMKQLQETYNGIMSPAPAVVS
EEVKPADTAPAPETSAQ