Protein Info for IAI46_00545 in Serratia liquefaciens MT49

Annotation: biofilm formation regulator HmsP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 668 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 152 to 178 (27 residues), see Phobius details PF17154: GAPES3" amino acids 36 to 155 (120 residues), 183.3 bits, see alignment E=2.1e-58 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 239 to 401 (163 residues), 45.8 bits, see alignment E=2.7e-16 PF00990: GGDEF" amino acids 247 to 399 (153 residues), 74.3 bits, see alignment E=1.5e-24 PF00563: EAL" amino acids 420 to 653 (234 residues), 218.3 bits, see alignment E=1.6e-68

Best Hits

Swiss-Prot: 52% identical to PDEK_ECOLI: Probable cyclic di-GMP phosphodiesterase PdeK (pdeK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to srs:SerAS12_0114)

MetaCyc: 52% identical to c-di-GMP phosphodiesterase PdeK (Escherichia coli K-12 substr. MG1655)
Cyclic-guanylate-specific phosphodiesterase. [EC: 3.1.4.52]

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.1.4.52

Use Curated BLAST to search for 3.1.4.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (668 amino acids)

>IAI46_00545 biofilm formation regulator HmsP (Serratia liquefaciens MT49)
MRVRRSLTIKQMATVSGVALVTICIFIVIQLFHFVQQRRDDYAQQLENIAHSVRQPLAEA
VLRMDVPETKKVLNTLLPVGILTRADIVLPNEFQALHANFPPERPVPTMIARLFELPIQI
SVPLYSLERVPANPQPLAYLVLQADSFRMYQFILSMLSTMLSTYLLLALILSVAISWCMN
RLMVHPLRAMAKELENISQEEAPYHQLMLPALHQDDELGLLVRNYNRNQQRLAKAYAELS
RMSTRHPVTELPNQALFTALLEQHIASSLRPERFNLLVIGIETLHEASGVLNPTMREALL
LMLAKKLRECIDENGVLAQLSNTEFAILAKGVERPFHAMQLARRIMAQINAPLSLQEMPL
RPSASIGIAHYLNAGESAEQLLRSATSAMMSAHREGKNQVLFFEPSLTERTQKRLTQESE
ILHAIDQRRFTLFLQPQIDMQSNAVIGAEALLRWQQYDGSFTLPADVIPLAEELGVIVPL
GNWVLEEACRILADWQTRGITLPLAVNVSPIQMQHENFVPHLKNLLAQHRIDPRKLLLEI
TETVRIDDLDRALALLRELHDLGLSIALDDFGMGYSSLNYLNRLKCLPIDLIKIDKSFIQ
GLPMDDAMVRIVSSISEVLALPVMAEGVENAEQRDWLLQHGIHSGQGFLFARPLPRSEFE
AEFCPPPA