Protein Info for IAI46_00525 in Serratia liquefaciens MT49

Annotation: UDP-forming cellulose synthase catalytic subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 867 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 31 to 50 (20 residues), see Phobius details amino acids 147 to 165 (19 residues), see Phobius details amino acids 171 to 188 (18 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details amino acids 226 to 250 (25 residues), see Phobius details amino acids 520 to 539 (20 residues), see Phobius details amino acids 544 to 566 (23 residues), see Phobius details amino acids 637 to 657 (21 residues), see Phobius details amino acids 663 to 688 (26 residues), see Phobius details amino acids 833 to 853 (21 residues), see Phobius details TIGR03030: cellulose synthase catalytic subunit (UDP-forming)" amino acids 143 to 827 (685 residues), 958.6 bits, see alignment E=8.4e-293 PF13641: Glyco_tranf_2_3" amino acids 273 to 498 (226 residues), 67.8 bits, see alignment E=3.9e-22 PF00535: Glycos_transf_2" amino acids 276 to 445 (170 residues), 90.2 bits, see alignment E=4.7e-29 PF13506: Glyco_transf_21" amino acids 330 to 497 (168 residues), 32.2 bits, see alignment E=2.2e-11 PF13632: Glyco_trans_2_3" amino acids 354 to 563 (210 residues), 74.1 bits, see alignment E=4.3e-24 PF03552: Cellulose_synt" amino acids 449 to 568 (120 residues), 42.7 bits, see alignment E=9.1e-15 PF07238: PilZ" amino acids 692 to 788 (97 residues), 43.8 bits, see alignment E=8.2e-15

Best Hits

Swiss-Prot: 73% identical to BCSA_SALTY: Cellulose synthase catalytic subunit [UDP-forming] (bcsA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00694, cellulose synthase (UDP-forming) [EC: 2.4.1.12] (inferred from 70% identity to enc:ECL_04938)

MetaCyc: 73% identical to cellulose synthase catalytic subunit (Escherichia coli K-12 substr. MG1655)
Cellulose synthase (UDP-forming). [EC: 2.4.1.12]

Predicted SEED Role

"Cellulose synthase catalytic subunit [UDP-forming] (EC 2.4.1.12)" (EC 2.4.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (867 amino acids)

>IAI46_00525 UDP-forming cellulose synthase catalytic subunit (Serratia liquefaciens MT49)
MSRVMNLLLVPPVHQAVQTRYRNYRRHGSSAFTAFFTTLLVALGWIFLRFESPGWQRLRA
ARSYWFPHLSSSRPRPADALRYLVQGLWLLVFRTDRAPVTHHRFAGWRRLQLRYAQWLQT
LPQRLENAGLEQRSVERLGRMSQRMRRLLFIIVGVLAAILAILCISQPFDLPAQFVFVVL
LWAIAMVVRRVPGRLPGLMLIVLSLTVSCRYLWWRYTATLNWDDPLSLTCGLLLLIAETY
AWVVLVLGYFQTVWPLNRQPVPMPADSATWPTIDLLVPTYNEDLGVVKPTIYAALGIDWP
KEKVSIYILDDGNRPEFKAFAEEVGVKYIARPTHEHAKAGNINNALKQATGEFVAIFDCD
HVPTRSFLQLTMGWFFKDKKLAMLQTPHHFFSPDPFERNLGRFRQTPNEGTLFYGLVQDG
NDMWDATFFCGSCAILRRSALDEIGGIAVETVTEDAHTSLRLHRRGHTSAYIRIPQAAGL
ATESLSAHIGQRIRWARGMVQIFRLDNPLLGKGLKLAQRLCYANAMLHFLSGIPRLIFLT
APLAFLLLHAYIIFAPALAIALYVLPHMIHASLTNSRIQGKYRHSFWSEIYETVLAWYIA
RPTTVALFNPHKGKFNVTAKGGLVEEEHVDWVITRPYMFLVILNLAGLFFGVWRLGYGPA
DEVMTVIISLVWVLYNMTILGGAVAVAVEAKQVRQAHRVEIAMPAAIARADGHLFPCTLR
DYSDGGVGIEMRVADALKDGDKVSLLLKRGQQEYSFPCVVTRAFGSKVGIRMVSMTTREH
IDFIQCTFARADTWALWQDGFPEDKPIESLRDVLALGFRGYVRMADYAPPMVRRLLVGFT
TLIAWGVSFIPHGVGRAPAFSQKETVV