Protein Info for IAI46_00435 in Serratia liquefaciens MT49

Annotation: transcriptional regulator UhpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 PF00072: Response_reg" amino acids 5 to 114 (110 residues), 75.8 bits, see alignment E=3e-25 PF00196: GerE" amino acids 137 to 191 (55 residues), 66.4 bits, see alignment E=1.4e-22

Best Hits

Swiss-Prot: 65% identical to UHPA_ECOL6: Transcriptional regulatory protein UhpA (uhpA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K07686, two-component system, NarL family, uhpT operon response regulator UhpA (inferred from 99% identity to spe:Spro_0132)

Predicted SEED Role

"Transcriptional regulatory protein UhpA" in subsystem Hexose Phosphate Uptake System

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (196 amino acids)

>IAI46_00435 transcriptional regulator UhpA (Serratia liquefaciens MT49)
MTLRVAFIDDHDIVRSGFVQLLSLEADIQVVGEFSSAAQARAGLPGLEAEICICDISMPD
GSGLDLLADIPSGIRVVMLSMHDNPALVEMALERGACGFLSKRCKPEDLITAVRTVASGG
VYLMPEIAQQLARVKVDPLTRREREIALLLAQGQEVREIAVALGLSPKTVHVHRANLFAK
LGINNNVELAKRMLNL