Protein Info for IAI46_00385 in Serratia liquefaciens MT49

Annotation: NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 9 to 152 (144 residues), 29.7 bits, E=1.2e-10
• PF01370: Epimerase
  • amino acids 10 to 192 (183 residues), 74.7 bits, E=2.7e-24
• PF02719: Polysacc_synt_2
  • amino acids 10 to 161 (152 residues), 32.5 bits, E=1.9e-11
• PF13460: NAD_binding_10
  • amino acids 14 to 126 (113 residues), 37.8 bits, E=6.7e-13
• PF01073: 3Beta_HSD
  • amino acids 43 to 125 (83 residues), 35.9 bits, E=1.5e-12
• PF16363: GDP_Man_Dehyd
  • amino acids 44 to 191 (148 residues), 55.4 bits, E=2.6e-18
• PF07993: NAD_binding_4
  • amino acids 63 to 172 (110 residues), 30.4 bits, E=7.7e-11

Best Hits

KEGG orthology group: None (inferred from 95% identity to spe:Spro_0125)

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• stachyose degradation (7/7 steps found)
• D-galactose degradation I (Leloir pathway) (5/5 steps found)
• D-galactose detoxification (3/3 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (5/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (2/2 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• colanic acid building blocks biosynthesis (8/11 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• UDP-sugars interconversion (2/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (2/18 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2

Protein Sequence (249 amino acids)

>IAI46_00385 NAD(P)-dependent oxidoreductase (Serratia liquefaciens MT49)
MTLRTEFGRILITGAGGRVATAFRQSVGNRYQLRLAERDVSLLHNLQPNDEIISFDIADI
EACRSACANIDTVLHLAADPSPDADFCNSLMDNNILGTFNIFRAAKDAGCKRVVFASSAQ
AVEGYPLDYQIRPQDAPKPKNLYGVSKAFGEGIAAYFAHQEGLSSLSVRIANFTTLERGE
QLSARDMSAFLSHRDAADLLERCLRIEGVHHAVVHGVSNNRYKRLSLEETTRLLGYYPQD
DAFSILGFD